PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 247aa    MW: 27368.7 Da    PI: 9.8214
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625430.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G g+W++ ++  g+ R++k+c++rw +yl
   XP_013625430.1 14 KGAWTKEEDQRLIDYIRIHGEGSWRSLPKSAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.94.2e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ eEd+ +++++ +lG++ W++Ia +++ gRt++++k++w+++
   XP_013625430.1  67 RGNFSDEEDKVIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.999961IPR017930Myb domain
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
SuperFamilySSF466891.65E-2913108IPR009057Homeodomain-like
PfamPF002492.5E-161461IPR001005SANT/Myb domain
CDDcd001672.33E-111661No hitNo description
PROSITE profilePS5129427.23262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2765116IPR009057Homeodomain-like
SMARTSM007176.0E-1666114IPR001005SANT/Myb domain
PfamPF002492.8E-1567111IPR001005SANT/Myb domain
CDDcd001671.18E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIDYIR IHGEGSWRSL PKSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SDEEDKVIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLRSHG  120
IDPQTHRPIK GSIAVIHSKT VPSQLSTVVT VSPQNGAVDN SFTIRPKTDI SSDNVASTSG  180
TTTDEDIRQN GDCYYNDNSG DRELNLDLTL GSGSTSLVRS GGRSGNGSSA DSKPWWDPVT  240
AARLSLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30141167108B-MYB
1h8a_C4e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU269361e-118U26936.1 Arabidopsis thaliana clone myb6 DNA-binding protein mRNA, complete cds.
GenBankAY0868131e-118AY086813.1 Arabidopsis thaliana clone 28019 mRNA, complete sequence.
GenBankAY5196041e-118AY519604.1 Arabidopsis thaliana MYB transcription factor (At4g09460) mRNA, complete cds.
GenBankBT0041711e-118BT004171.1 Arabidopsis thaliana clone RAFL15-40-D03 (R20880) putative myb family transcription factor (At4g09460) mRNA, complete cds.
GenBankBT0050851e-118BT005085.1 Arabidopsis thaliana clone U20880 putative myb family transcription factor (At4g09460) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625430.10.0PREDICTED: transcription repressor MYB6
SwissprotQ388511e-132MYB6_ARATH; Transcription repressor MYB6
TrEMBLA0A0D3B7U90.0A0A0D3B7U9_BRAOL; Uncharacterized protein
STRINGBra000680.1-P1e-142(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.11e-120myb domain protein 6